CJC-1295 Fără hormoni peptidici DAC

CJC-1295 Fără hormoni peptidici DAC

CJC 1295 este furnizat de obicei în flacoane care conțin 2 sau 5 mg pulbere liofilizată, deși cantitatea poate varia. Conținutul trebuie reconstituit adăugând o cantitate convenabilă de apă sterilă sau bacteriostatică. Dacă de exemplu se alege 2 ml și dozarea flaconului este de 2 mg, soluția rezultată are apoi o concentrație de 1 mg / ml sau 1000 mcg / mL.

Detalii produs

CJC-1295 fără hormoni peptidici DAC

Scurta introducere:

Numele produsului:

CJC-1295 NU DAC

Sinonime:

GRF modificat (1-29)

CAS:

863288-34-0

MF:

C152H252N44O42

MW:

3368.7

Secvenţă:

Y (d-A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2

Categorii de produse:

Peptidă, hormoni peptidici, peptide și proteine, steroizi și hormoni; Produse farmaceutice; Steroizi

Structura:

image001.jpg

Puritate

98%

Aspect

Pulbere cristalină albă

Pachet

5 mg / 10 mg / Flacoanele

folosire

Hormoni peptidici, culturism

Termen de plata

Uniunea occidentală, MoneyGram, Biotcoin, transfer bancar TT

metoda de livrare

FedEx, DHL, UPS, TNT, EMS, HKEMS, etc

image003.jpg


Ce este CJC-1295 NO DAC?

CJC 1295 NO DAC sau Mod GRF (1-29), cunoscut și sub denumirea de GRF tetrasubstituit (1-29), este o peptidă injectabilă folosită pentru a crește producția de hormon de creștere. Este în clasa analogilor de hormoni de creștere care eliberează hormoni (GHRH). Mod GRF (1-29) amplifică pulsul hormonului de creștere în același mod pe care îl face GHRH, dar nu induce pulsul de GH. De aceea, se recomandă combinarea Mod GRF (1-29) cu o peptidă din categoria GHRP (hormon de creștere care eliberează peptidă), deoarece dacă nu se produce pulsul GH în timpul injecției Mod GRF (1-29), atunci nu are nimic de amplifica.


CJC-1295 NU DAC Specificații:

Certificatul complet de analiză (COA) eliberat după fiecare lot final, după cum urmează:

image005.jpg


CJC 1295 Fără aplicație DAC:

Folosind atât CJC-1295 NO DAC (MOD GRF 1-29) cât și un GHRP oferă un răspuns sinergic cu GHRP care produce un impuls GH și CJC-1295 NO DAC care îl amplifică.

- Pierderea crescută de grăsime

- Cresterea musculara imbunatatita

- recuperare îmbunătățită

- Anti îmbătrânire

- Somn mai profund

- Piele și păr mai bune

CJC 1295 NU doză DAC:

CJC 1295 este furnizat de obicei în flacoane care conțin 2 sau 5 mg pulbere liofilizată, deși cantitatea poate varia. Conținutul trebuie reconstituit adăugând o cantitate convenabilă de apă sterilă sau bacteriostatică. Dacă de exemplu se alege 2 ml și dozarea flaconului este de 2 mg, soluția rezultată are apoi o concentrație de 1 mg / ml sau 1000 mcg / mL.

În momentul administrării, se folosește o seringă de insulină pentru a extrage și apoi injecta cantitatea dorită. În exemplul de mai sus, o doză de 1000 mcg ar necesita un volum de 1 mL sau „100 UI”, așa cum este marcat pe o seringă de insulină.


O pereche de:Hormoni peptidici Ipamorelin Următoarea:Follistatin 344 Hormoni peptidici

Anchetă